ST8SIA2 antibody (70R-7133)

Rabbit polyclonal ST8SIA2 antibody raised against the C terminal of ST8SIA2

Synonyms Polyclonal ST8SIA2 antibody, Anti-ST8SIA2 antibody, STSIA2-8, HsT19690 antibody, STSIA2 8, STSIA2-8 antibody, STSIA2 8 antibody, St8 Alpha-N-Acetyl-Neuraminide Alpha-28-Sialyltransferase 2 antibody, STX antibody, ST8SIA2, MGC116854 antibody, ST8SIA-II antibody, SIAT8B antibody, MGC116857 antibody
Specificity ST8SIA2 antibody was raised against the C terminal of ST8SIA2
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen ST8SIA2 antibody was raised using the C terminal of ST8SIA2 corresponding to a region with amino acids TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQAS
Assay Information ST8SIA2 Blocking Peptide, catalog no. 33R-9089, is also available for use as a blocking control in assays to test for specificity of this ST8SIA2 antibody

Images

Immunohistochemical staining using ST8SIA2 antibody (70R-7133)

ST8SIA2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST8SIA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST8SIA2 is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. ST8SIA2 may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ST8SIA2 antibody (70R-7133) | ST8SIA2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ST8SIA2 antibody (70R-7133) | ST8SIA2 antibody (70R-7133) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using ST8SIA2 antibody (70R-7133) | ST8SIA2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors