ST8SIA4 antibody (70R-5238)

Rabbit polyclonal ST8SIA4 antibody raised against the middle region of ST8SIA4

Synonyms Polyclonal ST8SIA4 antibody, Anti-ST8SIA4 antibody, St8 Alpha-N-Acetyl-Neuraminide Alpha-28-Sialyltransferase 4 antibody, ST8SIA-IV antibody, SIAT8D antibody, STSIA4-8 antibody, STSIA4 8, PST antibody, STSIA4 8 antibody, MGC34450 antibody, PST1 antibody, ST8SIA4, MGC61459 antibody, STSIA4-8
Specificity ST8SIA4 antibody was raised against the middle region of ST8SIA4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ST8SIA4 antibody was raised using the middle region of ST8SIA4 corresponding to a region with amino acids DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM
Assay Information ST8SIA4 Blocking Peptide, catalog no. 33R-2214, is also available for use as a blocking control in assays to test for specificity of this ST8SIA4 antibody

Images

Western Blot analysis using ST8SIA4 antibody (70R-5238)

ST8SIA4 antibody (70R-5238) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST8SIA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST8SIA4 catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). ST8SIA4, a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ST8SIA4 antibody (70R-5238) | ST8SIA4 antibody (70R-5238) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors