ST8SIA6 antibody (70R-6324)

Rabbit polyclonal ST8SIA6 antibody raised against the middle region of ST8SIA6

Synonyms Polyclonal ST8SIA6 antibody, Anti-ST8SIA6 antibody, ST8SIA6, ST8SIA-VI antibody, STSIA6 8, St8 Alpha-N-Acetyl-Neuraminide Alpha-28-Sialyltransferase 6 antibody, STSIA6-8, ST8Sia VI antibody, STSIA6-8 antibody, STSIA6 8 antibody, SIAT8F antibody
Specificity ST8SIA6 antibody was raised against the middle region of ST8SIA6
Cross Reactivity Human
Applications WB
Immunogen ST8SIA6 antibody was raised using the middle region of ST8SIA6 corresponding to a region with amino acids LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK
Assay Information ST8SIA6 Blocking Peptide, catalog no. 33R-4893, is also available for use as a blocking control in assays to test for specificity of this ST8SIA6 antibody

Images

Western Blot analysis using ST8SIA6 antibody (70R-6324)

ST8SIA6 antibody (70R-6324) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST8SIA6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sialic acid is a key determinate of oligosaccharide structures involved in cell-cell communication, cell-substrate interaction, adhesion, and protein targeting.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ST8SIA6 antibody (70R-6324) | ST8SIA6 antibody (70R-6324) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors