STAMBP antibody (70R-5741)

Rabbit polyclonal STAMBP antibody raised against the N terminal of STAMBP

Synonyms Polyclonal STAMBP antibody, Anti-STAMBP antibody, MGC126518 antibody, Stam Binding Protein antibody, AMSH antibody, MGC126516 antibody
Specificity STAMBP antibody was raised against the N terminal of STAMBP
Cross Reactivity Human
Applications WB
Immunogen STAMBP antibody was raised using the N terminal of STAMBP corresponding to a region with amino acids SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS
Assay Information STAMBP Blocking Peptide, catalog no. 33R-8355, is also available for use as a blocking control in assays to test for specificity of this STAMBP antibody


Western Blot analysis using STAMBP antibody (70R-5741)

STAMBP antibody (70R-5741) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STAMBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using STAMBP antibody (70R-5741) | STAMBP antibody (70R-5741) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors