STAMBPL1 antibody (70R-3245)

Rabbit polyclonal STAMBPL1 antibody raised against the N terminal of STAMBPL1

Synonyms Polyclonal STAMBPL1 antibody, Anti-STAMBPL1 antibody, KIAA1373 antibody, ALMalpha antibody, bA399O19.2 antibody, AMSH-FP antibody, FLJ31524 antibody, AMSH-LP antibody, Stam Binding Protein-Like 1 antibody
Specificity STAMBPL1 antibody was raised against the N terminal of STAMBPL1
Cross Reactivity Human
Applications WB
Immunogen STAMBPL1 antibody was raised using the N terminal of STAMBPL1 corresponding to a region with amino acids MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR
Assay Information STAMBPL1 Blocking Peptide, catalog no. 33R-5863, is also available for use as a blocking control in assays to test for specificity of this STAMBPL1 antibody


Western Blot analysis using STAMBPL1 antibody (70R-3245)

STAMBPL1 antibody (70R-3245) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STAMBPL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using STAMBPL1 antibody (70R-3245) | STAMBPL1 antibody (70R-3245) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors