STC1 antibody (70R-6215)

Rabbit polyclonal STC1 antibody raised against the N terminal of STC1

Synonyms Polyclonal STC1 antibody, Anti-STC1 antibody, STC 1, STC1, STC antibody, Stanniocalcin 1 antibody, STC 1 antibody, STC-1 antibody, STC-1
Specificity STC1 antibody was raised against the N terminal of STC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen STC1 antibody was raised using the N terminal of STC1 corresponding to a region with amino acids MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL
Assay Information STC1 Blocking Peptide, catalog no. 33R-6205, is also available for use as a blocking control in assays to test for specificity of this STC1 antibody

Images

Western Blot analysis using STC1 antibody (70R-6215)

STC1 antibody (70R-6215) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STC1 is a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. It contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STC1 antibody (70R-6215) | STC1 antibody (70R-6215) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors