STEAP3 antibody (70R-6280)

Rabbit polyclonal STEAP3 antibody raised against the C terminal of STEAP3

Synonyms Polyclonal STEAP3 antibody, Anti-STEAP3 antibody, STEAP 3, STEAP 3 antibody, STEAP-3 antibody, STEAP-3, TSAP6 antibody, STMP3 antibody, Steap Family Member 3 antibody, STEAP3, dudlin-2 antibody
Specificity STEAP3 antibody was raised against the C terminal of STEAP3
Cross Reactivity Human
Applications WB
Immunogen STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
Assay Information STEAP3 Blocking Peptide, catalog no. 33R-9427, is also available for use as a blocking control in assays to test for specificity of this STEAP3 antibody

Images

Western Blot analysis using STEAP3 antibody (70R-6280)

STEAP3 antibody (70R-6280) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STEAP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STEAP3 antibody (70R-6280) | STEAP3 antibody (70R-6280) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors