STEAP4 antibody (70R-6910)

Rabbit polyclonal STEAP4 antibody raised against the C terminal of STEAP4

Synonyms Polyclonal STEAP4 antibody, Anti-STEAP4 antibody, DKFZp666D049 antibody, STEAP-4, STEAP4, FLJ23153 antibody, STEAP-4 antibody, STEAP 4 antibody, TNFAIP9 antibody, STEAP 4, Steap Family Member 4 antibody, TIARP antibody, STAMP2 antibody
Specificity STEAP4 antibody was raised against the C terminal of STEAP4
Cross Reactivity Human
Applications WB
Immunogen STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA
Assay Information STEAP4 Blocking Peptide, catalog no. 33R-1165, is also available for use as a blocking control in assays to test for specificity of this STEAP4 antibody


Western Blot analysis using STEAP4 antibody (70R-6910)

STEAP4 antibody (70R-6910) used at 1 ug/ml to detect target protein. Positive control used is Human Jurkat cell Lysate.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STEAP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Metalloreductase has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It uses NAD(+) as acceptor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using STEAP4 antibody (70R-6910) | STEAP4 antibody (70R-6910) used at 1 ug/ml to detect target protein. Positive control used is Human Jurkat cell Lysate.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors