STIP1 antibody (70R-1288)

Rabbit polyclonal STIP1 antibody

Synonyms Polyclonal STIP1 antibody, Anti-STIP1 antibody, STI1 antibody, STI1L antibody, P60 antibody, STIP-1, STIP-1 antibody, IEF-SSP-3521 antibody, STIP 1, Stress-Induced-Phosphoprotein 1 antibody, HOP antibody, Hsp70/Hsp90-Organizing Protein antibody, STIP1, STIP 1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM
Assay Information STIP1 Blocking Peptide, catalog no. 33R-1327, is also available for use as a blocking control in assays to test for specificity of this STIP1 antibody

Images

Western Blot analysis using STIP1 antibody (70R-1288)

STIP1 antibody (70R-1288) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of STIP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STIP1 antibody (70R-1288) | STIP1 antibody (70R-1288) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors