STK16 antibody (70R-3483)

Rabbit polyclonal STK16 antibody raised against the middle region of STK16

Synonyms Polyclonal STK16 antibody, Anti-STK16 antibody, KRCT antibody, Serine/Threonine Kinase 16 antibody, STK-16, MPSK antibody, FLJ39635 antibody, STK-16 antibody, STK16, TSF1 antibody, PKL12 antibody, STK 16, STK 16 antibody
Specificity STK16 antibody was raised against the middle region of STK16
Cross Reactivity Human
Applications WB
Immunogen STK16 antibody was raised using the middle region of STK16 corresponding to a region with amino acids TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL
Assay Information STK16 Blocking Peptide, catalog no. 33R-9027, is also available for use as a blocking control in assays to test for specificity of this STK16 antibody

Images

Western Blot analysis using STK16 antibody (70R-3483)

STK16 antibody (70R-3483) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STK16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STK16 is a protein kinase that acts on both serine and threonine residues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STK16 antibody (70R-3483) | STK16 antibody (70R-3483) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors