STK3 antibody (70R-1658)

Rabbit polyclonal STK3 antibody

Synonyms Polyclonal STK3 antibody, Anti-STK3 antibody, Serine/Threonine Kinase 3 antibody, STK 3 antibody, STK-3, FLJ90748 antibody, KRS1 antibody, Ste20 Homolog Yeast antibody, STK-3 antibody, MST2 antibody, STK3, STK 3
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen STK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ
Assay Information STK3 Blocking Peptide, catalog no. 33R-3940, is also available for use as a blocking control in assays to test for specificity of this STK3 antibody


Immunohistochemical staining using STK3 antibody (70R-1658)

STK3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of STK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using STK3 antibody (70R-1658) | STK3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using STK3 antibody (70R-1658) | STK3 antibody (70R-1658) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors