STK38 antibody (70R-5769)

Rabbit polyclonal STK38 antibody raised against the C terminal of STK38

Synonyms Polyclonal STK38 antibody, Anti-STK38 antibody, STK-38, Serine/Threonine Kinase 38 antibody, NDR1 antibody, STK 38, STK 38 antibody, STK-38 antibody, STK38, NDR antibody
Specificity STK38 antibody was raised against the C terminal of STK38
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD
Assay Information STK38 Blocking Peptide, catalog no. 33R-3966, is also available for use as a blocking control in assays to test for specificity of this STK38 antibody

Images

Western Blot analysis using STK38 antibody (70R-5769)

STK38 antibody (70R-5769) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STK38 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STK38 antibody (70R-5769) | STK38 antibody (70R-5769) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors