STOML3 antibody (70R-7076)

Rabbit polyclonal STOML3 antibody

Synonyms Polyclonal STOML3 antibody, Anti-STOML3 antibody, Epb7.2l antibody, STOML 3 antibody, STOML 3, STOML-3 antibody, Epb72-Like 3 antibody, STOML-3, SRO antibody, STOML3, Stomatin like 3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC
Assay Information STOML3 Blocking Peptide, catalog no. 33R-8431, is also available for use as a blocking control in assays to test for specificity of this STOML3 antibody


Western Blot analysis using STOML3 antibody (70R-7076)

STOML3 antibody (70R-7076) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STOML3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of STOML3 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using STOML3 antibody (70R-7076) | STOML3 antibody (70R-7076) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors