STRA13 antibody (70R-4065)

Rabbit polyclonal STRA13 antibody

Synonyms Polyclonal STRA13 antibody, Anti-STRA13 antibody, STRA-13, STRA13, STRA-13 antibody, Stimulated By Retinoic Acid 13 Homolog antibody, STRA 13, MGC14480 antibody, STRA 13 antibody, E3 antibody
Cross Reactivity Human
Applications WB
Immunogen STRA13 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD
Assay Information STRA13 Blocking Peptide, catalog no. 33R-5917, is also available for use as a blocking control in assays to test for specificity of this STRA13 antibody


Western Blot analysis using STRA13 antibody (70R-4065)

STRA13 antibody (70R-4065) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 7 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STRA13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STRA13 is a DNA-binding component of the FA core complex involved in DNA damage repair and genome maintenance.STRA13 is recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions. As a component of the APITD1/CENPS complex,STRA13 is also essential for the stable assembly of the outer kinetchore.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using STRA13 antibody (70R-4065) | STRA13 antibody (70R-4065) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors