STS antibody (70R-7512)

Rabbit polyclonal STS antibody

Synonyms Polyclonal STS antibody, Anti-STS antibody, Steroid Sulfatase antibody, SSDD antibody, ASC antibody, ES antibody, ARSC antibody, Microsomal Isozyme S antibody, ARSC1 antibody
Cross Reactivity Human
Applications WB
Immunogen STS antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY
Assay Information STS Blocking Peptide, catalog no. 33R-2652, is also available for use as a blocking control in assays to test for specificity of this STS antibody

Images

Western Blot analysis using STS antibody (70R-7512)

STS antibody (70R-7512) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STS antibody (70R-7512) | STS antibody (70R-7512) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors