STUB1 antibody (70R-2247)

Rabbit polyclonal STUB1 antibody raised against the N terminal of STUB1

Synonyms Polyclonal STUB1 antibody, Anti-STUB1 antibody, STUB1, UBOX1 antibody, NY-CO-7 antibody, STUB-1 antibody, CHIP antibody, STUB-1, SDCCAG7 antibody, STUB 1 antibody, STUB 1, Stip1 Homology And U-Box Containing Protein 1 antibody, HSPABP2 antibody
Specificity STUB1 antibody was raised against the N terminal of STUB1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen STUB1 antibody was raised using the N terminal of STUB1 corresponding to a region with amino acids MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG
Assay Information STUB1 Blocking Peptide, catalog no. 33R-6139, is also available for use as a blocking control in assays to test for specificity of this STUB1 antibody

Images

Western Blot analysis using STUB1 antibody (70R-2247)

STUB1 antibody (70R-2247) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STUB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STUB1 modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It has E3 ubiquitin-protein ligase activity and targets misfolded chaperone substrates towards proteasomal degradation. STUB1 mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STUB1 antibody (70R-2247) | STUB1 antibody (70R-2247) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors