STYK1 antibody (70R-6389)

Rabbit polyclonal STYK1 antibody raised against the C terminal of STYK1

Synonyms Polyclonal STYK1 antibody, Anti-STYK1 antibody, STYK-1, STYK-1 antibody, STYK 1 antibody, SuRTK106 antibody, NOK antibody, DKFZp761P1010 antibody, Serine/Threonine/Tyrosine Kinase 1 antibody, STYK 1, STYK1
Specificity STYK1 antibody was raised against the C terminal of STYK1
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI
Assay Information STYK1 Blocking Peptide, catalog no. 33R-7060, is also available for use as a blocking control in assays to test for specificity of this STYK1 antibody

Images

Western Blot analysis using STYK1 antibody (70R-6389)

STYK1 antibody (70R-6389) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STYK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STYK1 antibody (70R-6389) | STYK1 antibody (70R-6389) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors