SULT1C2 antibody (70R-2216)

Rabbit polyclonal SULT1C2 antibody raised against the C terminal of SULT1C2

Synonyms Polyclonal SULT1C2 antibody, Anti-SULT1C2 antibody, ST1C2 antibody, humSULTC2 antibody, SULTC2 1 antibody, ST1C1 antibody, SULTC2-1, SULT1C1 antibody, SULTC2 1, Sulfotransferase Family Cytosolic 1C Member 2 antibody, SULT1C2, SULTC2-1 antibody
Specificity SULT1C2 antibody was raised against the C terminal of SULT1C2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SULT1C2 antibody was raised using the C terminal of SULT1C2 corresponding to a region with amino acids LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
Assay Information SULT1C2 Blocking Peptide, catalog no. 33R-4859, is also available for use as a blocking control in assays to test for specificity of this SULT1C2 antibody

Images

Western Blot analysis using SULT1C2 antibody (70R-2216)

SULT1C2 antibody (70R-2216) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SULT1C2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1C2 is a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SULT1C2 antibody (70R-2216) | SULT1C2 antibody (70R-2216) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors