Sult1c2 Blocking Peptide (33R-10348)

A synthetic peptide for use as a blocking control in assays to test for specificity of Sult1c2 antibody, catalog no. 70R-8805

Synonyms Sult1c2 control peptide, Sult1c2 antibody Blocking Peptide, Anti-Sult1c2 Blocking Peptide, sulfotransferase family, cytosolic, 1C, member 2 Blocking Peptide, MGC112625 Blocking Peptide, MGC124969ST1C2\" Blocking Peptide, Sult1c2, Sultc2-1, Sultc2 1, Sultc2-1 Blocking Peptide, Sultc2 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KCQRTIIQHRHPFIEWARPPQPSGVDKANAMPAPRILRTHLPTQLLPPSF
Molecular Weight 32 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sult1c2 catalyzes the sulfation of p-nitrophenol; localized to lysosomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors