SUPV3L1 antibody (70R-4616)

Rabbit polyclonal SUPV3L1 antibody

Synonyms Polyclonal SUPV3L1 antibody, Anti-SUPV3L1 antibody, SUPVL1-3 antibody, SUV3 antibody, SUPVL1-3, SUPVL1 3 antibody, Suppressor Of Var1 3-Like 1 antibody, SUPVL1 3, SUPV3L1
Cross Reactivity Human
Applications WB
Immunogen SUPV3L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFH
Assay Information SUPV3L1 Blocking Peptide, catalog no. 33R-7571, is also available for use as a blocking control in assays to test for specificity of this SUPV3L1 antibody

Images

Western Blot analysis using SUPV3L1 antibody (70R-4616)

SUPV3L1 antibody (70R-4616) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SUPV3L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SUPV3L1 is an ATPase and DNA/RNA helicase able to unwind DNA/DNA, DNA/RNA and RNA/RNA duplexes in the 5'-3' direction. SUPV3L1 may protect cells from apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SUPV3L1 antibody (70R-4616) | SUPV3L1 antibody (70R-4616) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors