SURF4 antibody (70R-6349)

Rabbit polyclonal SURF4 antibody raised against the N terminal of SURF4

Synonyms Polyclonal SURF4 antibody, Anti-SURF4 antibody, SURF 4 antibody, SURF4, SURF-4 antibody, Surfeit 4 antibody, ERV29 antibody, SURF-4, MGC102753 antibody, SURF 4, FLJ22993 antibody
Specificity SURF4 antibody was raised against the N terminal of SURF4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ
Assay Information SURF4 Blocking Peptide, catalog no. 33R-3504, is also available for use as a blocking control in assays to test for specificity of this SURF4 antibody

Images

Western Blot analysis using SURF4 antibody (70R-6349)

SURF4 antibody (70R-6349) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SURF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SURF4 antibody (70R-6349) | SURF4 antibody (70R-6349) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors