SUSD4 antibody (70R-6884)

Rabbit polyclonal SUSD4 antibody raised against the N terminal of SUSD4

Synonyms Polyclonal SUSD4 antibody, Anti-SUSD4 antibody, SUSD 4 antibody, SUSD4, Sushi Domain Containing 4 antibody, SUSD-4, SUSD-4 antibody, FLJ10052 antibody, PRO222 antibody, SUSD 4
Specificity SUSD4 antibody was raised against the N terminal of SUSD4
Cross Reactivity Human
Applications WB
Immunogen SUSD4 antibody was raised using the N terminal of SUSD4 corresponding to a region with amino acids MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG
Assay Information SUSD4 Blocking Peptide, catalog no. 33R-6626, is also available for use as a blocking control in assays to test for specificity of this SUSD4 antibody

Images

Western Blot analysis using SUSD4 antibody (70R-6884)

SUSD4 antibody (70R-6884) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SUSD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SUSD4 antibody (70R-6884) | SUSD4 antibody (70R-6884) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors