SV2A antibody (70R-6572)

Rabbit polyclonal SV2A antibody raised against the middle region of SV2A

Synonyms Polyclonal SV2A antibody, Anti-SV2A antibody, KIAA0736 antibody, SV2 antibody, Synaptic Vesicle Glycoprotein 2A antibody, SVA 2, SV2A, SVA-2 antibody, SVA 2 antibody, SVA-2
Specificity SV2A antibody was raised against the middle region of SV2A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SV2A antibody was raised using the middle region of SV2A corresponding to a region with amino acids LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT
Assay Information SV2A Blocking Peptide, catalog no. 33R-4916, is also available for use as a blocking control in assays to test for specificity of this SV2A antibody

Images

Western Blot analysis using SV2A antibody (70R-6572)

SV2A antibody (70R-6572) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SV2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SV2A plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. It positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SV2A antibody (70R-6572) | SV2A antibody (70R-6572) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors