SYCP3 antibody (70R-2271)

Rabbit polyclonal SYCP3 antibody raised against the N terminal of SYCP3

Synonyms Polyclonal SYCP3 antibody, Anti-SYCP3 antibody, SYCP 3, Synaptonemal Complex Protein 3 antibody, COR1 antibody, SYCP-3, SYCP 3 antibody, SCP3 antibody, MGC71888 antibody, SYCP3, SYCP-3 antibody
Specificity SYCP3 antibody was raised against the N terminal of SYCP3
Cross Reactivity Human
Applications WB
Immunogen SYCP3 antibody was raised using the N terminal of SYCP3 corresponding to a region with amino acids VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE
Assay Information SYCP3 Blocking Peptide, catalog no. 33R-9825, is also available for use as a blocking control in assays to test for specificity of this SYCP3 antibody

Images

Western Blot analysis using SYCP3 antibody (70R-2271)

SYCP3 antibody (70R-2271) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYCP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYCP3 is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It has an essential meiotic function in spermatogenesis. SYCP3 may be important for testis development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SYCP3 antibody (70R-2271) | SYCP3 antibody (70R-2271) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors