SYDE1 antibody (70R-3867)

Rabbit polyclonal SYDE1 antibody

Synonyms Polyclonal SYDE1 antibody, Anti-SYDE1 antibody, SYDE 1, 7h3 antibody, FLJ13511 antibody, SYDE-1, Synapse Defective 1 Rho Gtpase Homolog 1 antibody, SYDE1, SYDE-1 antibody, SYDE 1 antibody
Cross Reactivity Human
Applications WB
Immunogen SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG
Assay Information SYDE1 Blocking Peptide, catalog no. 33R-7360, is also available for use as a blocking control in assays to test for specificity of this SYDE1 antibody

Images

Western Blot analysis using SYDE1 antibody (70R-3867)

SYDE1 antibody (70R-3867) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYDE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SYDE1 antibody (70R-3867) | SYDE1 antibody (70R-3867) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors