Symplekin antibody (70R-6031)

Rabbit polyclonal Symplekin antibody raised against the middle region of SYMPK

Synonyms Polyclonal Symplekin antibody, Anti-Symplekin antibody, FLJ27092 antibody, SYMPK antibody, SPK antibody, SYM antibody
Specificity Symplekin antibody was raised against the middle region of SYMPK
Cross Reactivity Human
Applications WB
Immunogen Symplekin antibody was raised using the middle region of SYMPK corresponding to a region with amino acids GPLPKETAAGGLTLKEERSPQTLAPVGEDAMKTPSPAAEDAREPEAKGNS
Assay Information Symplekin Blocking Peptide, catalog no. 33R-3475, is also available for use as a blocking control in assays to test for specificity of this Symplekin antibody

Images

Western Blot analysis using Symplekin antibody (70R-6031)

Symplekin antibody (70R-6031) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYMPK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Symplekin antibody (70R-6031) | Symplekin antibody (70R-6031) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors