Synaptogyrin 2 antibody (70R-6322)

Rabbit polyclonal Synaptogyrin 2 antibody raised against the N terminal of SYNGR2

Synonyms Polyclonal Synaptogyrin 2 antibody, Anti-Synaptogyrin 2 antibody, Synaptogyrin 2, Synaptogyrin 2, SYNGR2 antibody, Synaptogyrin -2, Synaptogyrin 2 antibody, Synaptogyrin -2 antibody, MGC102914 antibody
Specificity Synaptogyrin 2 antibody was raised against the N terminal of SYNGR2
Cross Reactivity Human
Applications WB
Immunogen Synaptogyrin 2 antibody was raised using the N terminal of SYNGR2 corresponding to a region with amino acids ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA
Assay Information Synaptogyrin 2 Blocking Peptide, catalog no. 33R-2727, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 2 antibody

Images

Western Blot analysis using Synaptogyrin 2 antibody (70R-6322)

Synaptogyrin 2 antibody (70R-6322) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYNGR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYNGR2 is an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Synaptogyrin 2 antibody (70R-6322) | Synaptogyrin 2 antibody (70R-6322) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors