Synaptojanin 1 antibody (70R-4877)

Rabbit polyclonal Synaptojanin 1 antibody raised against the N terminal of SYNJ1

Synonyms Polyclonal Synaptojanin 1 antibody, Anti-Synaptojanin 1 antibody, INPP5G antibody, Synaptojanin 1, Synaptojanin -1, Synaptojanin 1 antibody, SYNJ1 antibody, Synaptojanin -1 antibody, Synaptojanin 1
Specificity Synaptojanin 1 antibody was raised against the N terminal of SYNJ1
Cross Reactivity Human
Applications WB
Immunogen Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR
Assay Information Synaptojanin 1 Blocking Peptide, catalog no. 33R-3930, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 1 antibody


Western Blot analysis using Synaptojanin 1 antibody (70R-4877)

Synaptojanin 1 antibody (70R-4877) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 143 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYNJ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Synaptojanin 1 antibody (70R-4877) | Synaptojanin 1 antibody (70R-4877) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors