Synaptophysin antibody (70R-6569)

Rabbit polyclonal Synaptophysin antibody raised against the N terminal of SYP

Synonyms Polyclonal Synaptophysin antibody, Anti-Synaptophysin antibody, SYP antibody
Specificity Synaptophysin antibody was raised against the N terminal of SYP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
Assay Information Synaptophysin Blocking Peptide, catalog no. 33R-6191, is also available for use as a blocking control in assays to test for specificity of this Synaptophysin antibody

Images

Immunofluorescent staining using Synaptophysin antibody (70R-6569)

Synaptophysin antibody used at a concentration of 10 ug/ml to detect synaptic puncta in rodent brain (red). Nuclei were stained with DAPI.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunofluorescent staining using Synaptophysin antibody (70R-6569) | Synaptophysin antibody used at a concentration of 10 ug/ml to detect synaptic puncta in rodent brain (red). Nuclei were stained with DAPI.
  • Western Blot analysis using Synaptophysin antibody (70R-6569) | Synaptophysin antibody (70R-6569) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors