SYNCRIP antibody (70R-1309)

Rabbit polyclonal SYNCRIP antibody raised against the N terminal of SYNCRIP

Synonyms Polyclonal SYNCRIP antibody, Anti-SYNCRIP antibody, Synaptotagmin Binding Cytoplasmic Rna Interacting Protein antibody
Specificity SYNCRIP antibody was raised against the N terminal of SYNCRIP
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen SYNCRIP antibody was raised using the N terminal of SYNCRIP corresponding to a region with amino acids MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG
Assay Information SYNCRIP Blocking Peptide, catalog no. 33R-5770, is also available for use as a blocking control in assays to test for specificity of this SYNCRIP antibody

Images

Western Blot analysis using SYNCRIP antibody (70R-1309)

SYNCRIP antibody (70R-1309) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SYNCRIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SYNCRIP antibody (70R-1309) | SYNCRIP antibody (70R-1309) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors