Syntaxin 19 antibody (70R-3408)

Rabbit polyclonal Syntaxin 19 antibody raised against the N terminal of STX19

Synonyms Polyclonal Syntaxin 19 antibody, Anti-Syntaxin 19 antibody, MGC21382 antibody, Syntaxin 19, STX19 antibody, Syntaxin 19, Syntaxin 19 antibody, Syntaxin -19 antibody, Syntaxin -19
Specificity Syntaxin 19 antibody was raised against the N terminal of STX19
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Syntaxin 19 antibody was raised using the N terminal of STX19 corresponding to a region with amino acids LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR
Assay Information Syntaxin 19 Blocking Peptide, catalog no. 33R-5327, is also available for use as a blocking control in assays to test for specificity of this Syntaxin 19 antibody


Western Blot analysis using Syntaxin 19 antibody (70R-3408)

Syntaxin 19 antibody (70R-3408) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STX19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Syntaxin 19 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Syntaxin 19 antibody (70R-3408) | Syntaxin 19 antibody (70R-3408) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors