Syntrophin Beta 1 antibody (70R-6691)

Rabbit polyclonal Syntrophin Beta 1 antibody

Synonyms Polyclonal Syntrophin Beta 1 antibody, Anti-Syntrophin Beta 1 antibody, Syntrophin Beta 1, BSYN2 antibody, SNT2B1 antibody, Dystrophin-Associated Protein A1 antibody, Syntrophin Beta -1, TIP-43 antibody, FLJ22442 antibody, DAPA1B antibody, Syntrophin Beta 1, SNT2 antibody, A1B antibody, 59-DAP antibody, Syntrophin Beta 1 antibody, Syntrophin Beta -1 antibody, SNTB1 antibody, MGC111389 antibody
Cross Reactivity Human
Applications WB
Immunogen Syntrophin Beta 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQEL
Assay Information Syntrophin Beta 1 Blocking Peptide, catalog no. 33R-3153, is also available for use as a blocking control in assays to test for specificity of this Syntrophin Beta 1 antibody

Images

Western Blot analysis using Syntrophin Beta 1 antibody (70R-6691)

Syntrophin Beta 1 antibody (70R-6691) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNTB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Syntrophin Beta 1 antibody (70R-6691) | Syntrophin Beta 1 antibody (70R-6691) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors