Syntrophin Gamma 1 antibody (70R-3733)

Rabbit polyclonal Syntrophin Gamma 1 antibody raised against the middle region of SNTG1

Synonyms Polyclonal Syntrophin Gamma 1 antibody, Anti-Syntrophin Gamma 1 antibody, Syntrophin Gamma 1, Syntrophin Gamma -1 antibody, SYN4 antibody, SNTG1 antibody, Syntrophin Gamma 1, Syntrophin Gamma 1 antibody, Syntrophin Gamma -1, G1SYN antibody
Specificity Syntrophin Gamma 1 antibody was raised against the middle region of SNTG1
Cross Reactivity Human
Applications WB
Immunogen Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS
Assay Information Syntrophin Gamma 1 Blocking Peptide, catalog no. 33R-7908, is also available for use as a blocking control in assays to test for specificity of this Syntrophin Gamma 1 antibody

Images

Western Blot analysis using Syntrophin Gamma 1 antibody (70R-3733)

Syntrophin Gamma 1 antibody (70R-3733) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNTG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Syntrophin Gamma 1 antibody (70R-3733) | Syntrophin Gamma 1 antibody (70R-3733) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors