SYT9 antibody (70R-7051)

Rabbit polyclonal SYT9 antibody raised against the middle region of SYT9

Synonyms Polyclonal SYT9 antibody, Anti-SYT9 antibody, SYT9, Synaptotagmin Ix antibody, SYT 9, SYT-9 antibody, FLJ45896 antibody, SYT 9 antibody, SYT-9
Specificity SYT9 antibody was raised against the middle region of SYT9
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SYT9 antibody was raised using the middle region of SYT9 corresponding to a region with amino acids PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL
Assay Information SYT9 Blocking Peptide, catalog no. 33R-7008, is also available for use as a blocking control in assays to test for specificity of this SYT9 antibody


Western Blot analysis using SYT9 antibody (70R-7051)

SYT9 antibody (70R-7051) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYT9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYT9 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SYT9 antibody (70R-7051) | SYT9 antibody (70R-7051) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors