SYVN1 antibody (70R-1869)

Rabbit polyclonal SYVN1 antibody raised against the middle region of SYVN1

Synonyms Polyclonal SYVN1 antibody, Anti-SYVN1 antibody, HRD1 antibody, SYVN 1, KIAA1810 antibody, MGC40372 antibody, Synovial Cell Cycle Inhibitor 1 antibody, SYVN1, SYVN-1, SYVN 1 antibody, SYVN-1 antibody, Synoviolin antibody
Specificity SYVN1 antibody was raised against the middle region of SYVN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SYVN1 antibody was raised using the middle region of SYVN1 corresponding to a region with amino acids QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAALSRPSGAA
Assay Information SYVN1 Blocking Peptide, catalog no. 33R-7565, is also available for use as a blocking control in assays to test for specificity of this SYVN1 antibody

Images

Western Blot analysis using SYVN1 antibody (70R-1869)

SYVN1 antibody (70R-1869) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SYVN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYVN1 is a protein involved in endoplasmic reticulum (ER)-associated degradation. The protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SYVN1 antibody (70R-1869) | SYVN1 antibody (70R-1869) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors