TACC3 antibody (70R-4547)

Rabbit polyclonal TACC3 antibody raised against the middle region of TACC3

Synonyms Polyclonal TACC3 antibody, Anti-TACC3 antibody, TACC 3 antibody, TACC 3, MGC117382 antibody, TACC-3, TACC3, MGC133242 antibody, TACC-3 antibody, ERIC1 antibody, Transforming Acidic Coiled-Coil Containing Protein 3 antibody
Specificity TACC3 antibody was raised against the middle region of TACC3
Cross Reactivity Human
Applications WB
Immunogen TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKES
Assay Information TACC3 Blocking Peptide, catalog no. 33R-7132, is also available for use as a blocking control in assays to test for specificity of this TACC3 antibody

Images

Western Blot analysis using TACC3 antibody (70R-4547)

TACC3 antibody (70R-4547) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TACC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this gene has not yet been determined; however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TACC3 antibody (70R-4547) | TACC3 antibody (70R-4547) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors