Tachykinin 3 antibody (70R-5340)

Rabbit polyclonal Tachykinin 3 antibody

Synonyms Polyclonal Tachykinin 3 antibody, Anti-Tachykinin 3 antibody, Tachykinin 3, Tachykinin -3 antibody, Tachykinin -3, NKNB antibody, Tachykinin 3 antibody, Neuromedin K Neurokinin Beta antibody, NKB antibody, Tachykinin 3, ZNEUROK1 antibody, PRO1155 antibody, TAC3 antibody
Cross Reactivity Human
Applications WB
Immunogen Tachykinin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF
Assay Information Tachykinin 3 Blocking Peptide, catalog no. 33R-8189, is also available for use as a blocking control in assays to test for specificity of this Tachykinin 3 antibody

Images

Western Blot analysis using Tachykinin 3 antibody (70R-5340)

Tachykinin 3 antibody (70R-5340) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TAC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tachykinin 3 antibody (70R-5340) | Tachykinin 3 antibody (70R-5340) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors