TAF13 Blocking Peptide (33R-1087)

A synthetic peptide for use as a blocking control in assays to test for specificity of TAF13 antibody, catalog no. 70R-8716

Synonyms TAF13 control peptide, TAF13 antibody Blocking Peptide, Anti-TAF13 Blocking Peptide, TAF13 RNA polymerase II, TATA box binding protein, TBP-associated factor, 18kDa Blocking Peptide, MGC22425 Blocking Peptide, TAF2K Blocking Peptide, TAFII18 Blocking Peptide, TAF13, TAF-13, TAF 13, TAF-13 Blocking Peptide, TAF 13 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYT
Molecular Weight 14 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF13 is a small subunit associated with a subset of TFIID complexes. TAF13 interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors