TBC1D10C antibody (70R-3441)

Rabbit polyclonal TBC1D10C antibody raised against the N terminal of TBC1D10C

Synonyms Polyclonal TBC1D10C antibody, Anti-TBC1D10C antibody, TBC-1 antibody, Tbc1 Domain Family Member 10C antibody, TBC 1 antibody, MGC46488 antibody, TBC 1, TBC1, TBC-1, FLJ00332 antibody
Specificity TBC1D10C antibody was raised against the N terminal of TBC1D10C
Cross Reactivity Human
Applications WB
Immunogen TBC1D10C antibody was raised using the N terminal of TBC1D10C corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP
Assay Information TBC1D10C Blocking Peptide, catalog no. 33R-5723, is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody

Images

Western Blot analysis using TBC1D10C antibody (70R-3441)

TBC1D10C antibody (70R-3441) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBC1D10C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TBC1D10C antibody (70R-3441) | TBC1D10C antibody (70R-3441) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors