TBC1D10C antibody (70R-3614)

Rabbit polyclonal TBC1D10C antibody raised against the N terminal of TBC1D10C

Synonyms Polyclonal TBC1D10C antibody, Anti-TBC1D10C antibody, MGC46488 antibody, TBC-1, TBC 1, FLJ00332 antibody, TBC 1 antibody, TBC1, TBC-1 antibody, Tbc1 Domain Family Member 10C antibody
Specificity TBC1D10C antibody was raised against the N terminal of TBC1D10C
Cross Reactivity Human
Applications WB
Immunogen TBC1D10C antibody was raised using the N terminal of TBC1D10C corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP
Assay Information TBC1D10C Blocking Peptide, catalog no. 33R-5722, is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody

Images

Western Blot analysis using TBC1D10C antibody (70R-3614)

TBC1D10C antibody (70R-3614) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBC1D10C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin that also inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TBC1D10C antibody (70R-3614) | TBC1D10C antibody (70R-3614) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors