TBC1D16 antibody (70R-3912)

Rabbit polyclonal TBC1D16 antibody raised against the N terminal of TBC1D16

Synonyms Polyclonal TBC1D16 antibody, Anti-TBC1D16 antibody, TBC 1, TBC 1 antibody, TBC-1 antibody, TBC1, Tbc1 Domain Family Member 16 antibody, TBC-1, MGC25062 antibody, FLJ20748 antibody
Specificity TBC1D16 antibody was raised against the N terminal of TBC1D16
Cross Reactivity Human
Applications WB
Immunogen TBC1D16 antibody was raised using the N terminal of TBC1D16 corresponding to a region with amino acids EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG
Assay Information TBC1D16 Blocking Peptide, catalog no. 33R-2588, is also available for use as a blocking control in assays to test for specificity of this TBC1D16 antibody


Western Blot analysis using TBC1D16 antibody (70R-3912)

TBC1D16 antibody (70R-3912) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBC1D16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TBC1D16 may act as a GTPase-activating protein for Rab family proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TBC1D16 antibody (70R-3912) | TBC1D16 antibody (70R-3912) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors