TBCB antibody (70R-3673)

Rabbit polyclonal TBCB antibody raised against the C terminal of TBCB

Synonyms Polyclonal TBCB antibody, Anti-TBCB antibody, CG22 antibody, MGC14625 antibody, CKAPI antibody, Tubulin Folding Cofactor B antibody, CKAP1 antibody
Specificity TBCB antibody was raised against the C terminal of TBCB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Assay Information TBCB Blocking Peptide, catalog no. 33R-10065, is also available for use as a blocking control in assays to test for specificity of this TBCB antibody


Western Blot analysis using TBCB antibody (70R-3673)

TBCB antibody (70R-3673) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBCB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TBCB antibody (70R-3673) | TBCB antibody (70R-3673) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors