TBCCD1 antibody (70R-3697)

Rabbit polyclonal TBCCD1 antibody raised against the N terminal of TBCCD1

Synonyms Polyclonal TBCCD1 antibody, Anti-TBCCD1 antibody, TBCCD 1, TBCCD1, TBCCD-1 antibody, TBCCD-1, Tbcc Domain Containing 1 antibody, FLJ10560 antibody, TBCCD 1 antibody
Specificity TBCCD1 antibody was raised against the N terminal of TBCCD1
Cross Reactivity Human
Applications WB
Immunogen TBCCD1 antibody was raised using the N terminal of TBCCD1 corresponding to a region with amino acids WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL
Assay Information TBCCD1 Blocking Peptide, catalog no. 33R-9990, is also available for use as a blocking control in assays to test for specificity of this TBCCD1 antibody


Western Blot analysis using TBCCD1 antibody (70R-3697)

TBCCD1 antibody (70R-3697) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBCCD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TBCCD1 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TBCCD1 antibody (70R-3697) | TBCCD1 antibody (70R-3697) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors