TBK1 antibody (70R-5732)

Rabbit polyclonal TBK1 antibody raised against the N terminal of TBK1

Synonyms Polyclonal TBK1 antibody, Anti-TBK1 antibody, NAK antibody, TBK-1 antibody, TBK 1 antibody, Tank-Binding Kinase 1 antibody, TBK1, T2K antibody, TBK-1, FLJ11330 antibody, TBK 1
Specificity TBK1 antibody was raised against the N terminal of TBK1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM
Assay Information TBK1 Blocking Peptide, catalog no. 33R-2352, is also available for use as a blocking control in assays to test for specificity of this TBK1 antibody

Images

Western blot analysis using TBK1 antibody (70R-5732)

Recommended TBK1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. TBK1 is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. For example, the protein can form a complex with the IKB protein TANK and TRAF2 and release the NFKB inhibition caused by TANK.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using TBK1 antibody (70R-5732) | Recommended TBK1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors