TBK1 antibody (70R-5838)

Rabbit polyclonal TBK1 antibody raised against the middle region of TBK1

Synonyms Polyclonal TBK1 antibody, Anti-TBK1 antibody, FLJ11330 antibody, NAK antibody, T2K antibody, TBK 1, Tank-Binding Kinase 1 antibody, TBK-1 antibody, TBK-1, TBK1, TBK 1 antibody
Specificity TBK1 antibody was raised against the middle region of TBK1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TBK1 antibody was raised using the middle region of TBK1 corresponding to a region with amino acids QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ
Assay Information TBK1 Blocking Peptide, catalog no. 33R-7524, is also available for use as a blocking control in assays to test for specificity of this TBK1 antibody

Images

Western blot analysis using TBK1 antibody (70R-5838)

Recommended TBK1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using TBK1 antibody (70R-5838) | Recommended TBK1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors