TCAP antibody (70R-1249)

Rabbit polyclonal TCAP antibody

Synonyms Polyclonal TCAP antibody, Anti-TCAP antibody, Telethonin antibody, Titin-Cap antibody, TELE antibody, CMD1N antibody, LGMD2G antibody, telethonin antibody, T-cap antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TCAP antibody was raised using a synthetic peptide corresponding to a region with amino acids IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM
Assay Information TCAP Blocking Peptide, catalog no. 33R-4117, is also available for use as a blocking control in assays to test for specificity of this TCAP antibody

Western Blot analysis using TCAP antibody (70R-1249)

TCAP antibody (70R-1249) used at 5 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TCAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using TCAP antibody (70R-1249) | TCAP antibody (70R-1249) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors