TCTN3 antibody (70R-6648)

Rabbit polyclonal TCTN3 antibody raised against the middle region of TCTN3

Synonyms Polyclonal TCTN3 antibody, Anti-TCTN3 antibody, DKFZp564D116 antibody, C10orf61 antibody, TECT3 antibody, Tectonic Family Member 3 antibody
Specificity TCTN3 antibody was raised against the middle region of TCTN3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TCTN3 antibody was raised using the middle region of TCTN3 corresponding to a region with amino acids LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS
Assay Information TCTN3 Blocking Peptide, catalog no. 33R-5493, is also available for use as a blocking control in assays to test for specificity of this TCTN3 antibody

Images

Western Blot analysis using TCTN3 antibody (70R-6648)

TCTN3 antibody (70R-6648) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TCTN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TCTN3 may be involved in apoptosis regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TCTN3 antibody (70R-6648) | TCTN3 antibody (70R-6648) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors