TEC antibody (70R-4469)

Rabbit polyclonal TEC antibody raised against the middle region of TEC

Synonyms Polyclonal TEC antibody, Anti-TEC antibody, PSCTK4 antibody, Tec Protein Tyrosine Kinase antibody, MGC126760 antibody, MGC126762 antibody
Specificity TEC antibody was raised against the middle region of TEC
Cross Reactivity Human
Applications WB
Immunogen TEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG
Assay Information TEC Blocking Peptide, catalog no. 33R-9641, is also available for use as a blocking control in assays to test for specificity of this TEC antibody

Images

Western Blot analysis using TEC antibody (70R-4469)

TEC antibody (70R-4469) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TEC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surface antigens, heterotrimeric G-protein coupled receptors, and integrin molecules. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TEC antibody (70R-4469) | TEC antibody (70R-4469) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors