Tektin 4 antibody (70R-3712)

Rabbit polyclonal Tektin 4 antibody raised against the N terminal of TEKT4

Synonyms Polyclonal Tektin 4 antibody, Anti-Tektin 4 antibody, TEKT4 antibody, MGC27019 antibody, Tektin 4, Tektin 4 antibody, Tektin -4 antibody, Tektin 4, Tektin -4
Specificity Tektin 4 antibody was raised against the N terminal of TEKT4
Cross Reactivity Human
Applications WB
Immunogen Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQ
Assay Information Tektin 4 Blocking Peptide, catalog no. 33R-9288, is also available for use as a blocking control in assays to test for specificity of this Tektin 4 antibody


Western Blot analysis using Tektin 4 antibody (70R-3712)

Tektin 4 antibody (70R-3712) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TEKT4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Tektin 4 antibody (70R-3712) | Tektin 4 antibody (70R-3712) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors