Tenomodulin antibody (70R-6317)

Rabbit polyclonal Tenomodulin antibody raised against the middle region of TNMD

Synonyms Polyclonal Tenomodulin antibody, Anti-Tenomodulin antibody, TNMD antibody, TEM antibody, CHM1L antibody, CHM1-LIKE antibody, BRICD4 antibody
Specificity Tenomodulin antibody was raised against the middle region of TNMD
Cross Reactivity Human
Applications WB
Immunogen Tenomodulin antibody was raised using the middle region of TNMD corresponding to a region with amino acids QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI
Assay Information Tenomodulin Blocking Peptide, catalog no. 33R-7661, is also available for use as a blocking control in assays to test for specificity of this Tenomodulin antibody

Images

Western Blot analysis using Tenomodulin antibody (70R-6317)

Tenomodulin antibody (70R-6317) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNMD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tenomodulin antibody (70R-6317) | Tenomodulin antibody (70R-6317) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors